DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and cela1.3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:262 Identity:72/262 - (27%)
Similarity:117/262 - (44%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMV---FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTR 105
            |::.|..||.||.||.:   :|..::....||||||....|:|||||..:.:.....||:::...
Zfish    44 RVVGGEVAKPNSWPWQISLQYLSGSSYYHTCGGSLIRPGWVMTAAHCVDSPRTWRVVLGDHDIYN 108

  Fly   106 SEECTGYYCNFREEHM-VDAGFKHKLYDPNTHAN------DIAILRLS-----KSVVYRDNIRPI 158
            .|.        ||::: |.....|    ||.::|      |||:|.||     .|.|....:.|.
Zfish   109 HEG--------REQYISVSRAHIH----PNWNSNSLSSGYDIALLELSSDASLNSYVQLAALPPS 161

  Fly   159 CVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDA------LQTLDIRRQPPDVCAK--FIGQTIA 215
            ..|..:....|:        :|||:||......|      |..:|     .|.|::  :.|.|:.
Zfish   162 GQVLPNNNPCYI--------SGWGRTQTGGSLSAELKQAYLPVVD-----HDTCSRSDWWGSTVK 213

  Fly   216 GNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNC---QKASVFTDVLSHAE 276
            ....|.|:.....|:|||||||...:    :.::|..|:.|: ::..|   ::.:||:.|.::..
Zfish   214 NTMICGGDGTLAGCHGDSGGPLNCQV----SGQYVVHGVTSFVSSAGCNTNKRPTVFSRVSAYIS 274

  Fly   277 FI 278
            :|
Zfish   275 WI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/260 (27%)
Tryp_SPc 45..278 CDD:238113 70/259 (27%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.