DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CTRB2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:268 Identity:80/268 - (29%)
Similarity:114/268 - (42%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM 68
            ||:|.....|:..:..:| ||.|                 ||:||..|...|.||.|.|...|..
Human    11 ALLGTTFGCGVPAIHPVL-SGLS-----------------RIVNGEDAVPGSWPWQVSLQDKTGF 57

  Fly    69 FVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP 133
            ..||||||::..|:|||||.:....:|. .||:::...||      |.:...:... ||:..:..
Human    58 HFCGGSLISEDWVVTAAHCGVRTSDVVV-AGEFDQGSDEE------NIQVLKIAKV-FKNPKFSI 114

  Fly   134 NTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKID-------LLTATGWGKTQMESDS- 190
            .|..|||.:|:|:....:...:..:|          |...|       |...||||||:..::. 
Human   115 LTVNNDITLLKLATPARFSQTVSAVC----------LPSADDDFPAGTLCATTGWGKTKYNANKT 169

  Fly   191 -DALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
             |.||...:.......|.|..|:.|.....|||....:.|.|||||||   :..|: ..:..|||
Human   170 PDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPL---VCQKD-GAWTLVGI 230

  Fly   255 ASYTNRNC 262
            .|:.:|.|
Human   231 VSWGSRTC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/228 (32%)
Tryp_SPc 45..278 CDD:238113 71/227 (31%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 72/228 (32%)
Tryp_SPc 34..259 CDD:238113 71/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.