DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and KLK12

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:245 Identity:71/245 - (28%)
Similarity:99/245 - (40%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLI 76
            :|:.:...|...|.||...|            :|.||.....||.||.|.|...|.: .|||.||
Human     1 MGLSIFLLLCVLGLSQAATP------------KIFNGTECGRNSQPWQVGLFEGTSL-RCGGVLI 52

  Fly    77 TDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFK--HKLY--DPNTHA 137
            ..:.|||||||  :......||||:..::.:         ..|.:..:||.  |..|  ...:|.
Human    53 DHRWVLTAAHC--SGSRYWVRLGEHSLSQLD---------WTEQIRHSGFSVTHPGYLGASTSHE 106

  Fly   138 NDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTA------TGWGKTQMESD--SDALQ 194
            :|:.:|||...|....:::|:.:           ..|..||      :|||.|....:  .|.||
Human   107 HDLRLLRLRLPVRVTSSVQPLPL-----------PNDCATAGTECHVSGWGITNHPRNPFPDLLQ 160

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNW-DSNLCNGDSGGPL--GAVI 241
            .|::.......|.......|..|..|||.. ..:.|.|||||||  |.|:
Human   161 CLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/213 (31%)
Tryp_SPc 45..278 CDD:238113 65/212 (31%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 65/213 (31%)
Tryp_SPc 22..236 CDD:238113 65/212 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.