DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and zgc:92313

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:286 Identity:75/286 - (26%)
Similarity:112/286 - (39%) Gaps:99/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            ||:.|.:|...:.||.|.:.......||||::|::..||:|||||               ....:
Zfish    34 RIVGGSSAADGAWPWQVDIQGEKSKHVCGGTIISENWVLSAAHCF---------------PNPND 83

  Fly   109 CTGY--YCNFRE---------EH-----MVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRP 157
            .:||  |...::         .|     :|..|:.    ||.. ..|||::.|:...||.:.|:|
Zfish    84 ISGYLIYAGRQQLNGWNPDETSHRISRVVVPLGYT----DPQL-GQDIALVELATPFVYTERIQP 143

  Fly   158 ICVVW-------DHRWRHYLDKIDLLTATGWG----------------------KTQMESD---S 190
            :|:.:       |.|          ...||||                      .:|:..|   :
Zfish   144 VCLPYANVEFTSDMR----------CMITGWGDIREGVALQGVGPLQEVQVPIIDSQICQDMFLT 198

  Fly   191 DALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIA 255
            :..:.:|||  |..:||          .|..|..||  |.|||||||...|:..:   :||.||.
Zfish   199 NPTENIDIR--PDMMCA----------GFQQGGKDS--CQGDSGGPLACQISDGS---WVQAGIV 246

  Fly   256 SYTNRNCQKAS---VFTDVLSHAEFI 278
            |: ...|.:|:   |:..|.|...||
Zfish   247 SF-GLGCAEANRPGVYAKVSSFTNFI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/284 (26%)
Tryp_SPc 45..278 CDD:238113 72/283 (25%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 73/284 (26%)
Tryp_SPc 35..274 CDD:238113 74/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.