DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG11313

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:276 Identity:83/276 - (30%)
Similarity:121/276 - (43%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAY-RIINGHTAKYNSSPWMVFL----HSTTDM-FVCGGSLITDKLVLTAAHCFIA- 90
            ||    ...|| :|..|:........|||.|    |....: ..|.||||.::.|:|||||..| 
  Fly   107 CG----GDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAA 167

  Fly    91 --------NQHLVARLGEYERTRSEECTGYYCNFR------EEHMVDAGFKHKLYDPNTHANDIA 141
                    :..:..||||:..:...:|....|...      ||..:...|..:|:     .||||
  Fly   168 TRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLF-----WNDIA 227

  Fly   142 ILRLSKSVVYRDNIRPICV---VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPP 203
            ::||::.|.|..:|||:|:   |....|:    .....|..|||:|.....|.....|.:....|
  Fly   228 LIRLAREVAYSPSIRPVCLPSTVGLQNWQ----SGQAFTVAGWGRTLTSESSPVKMKLRVTYVEP 288

  Fly   204 DVC-AKFIGQTIAG-NQFCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK- 264
            .:| .|:....:.| :..|| |....:.|:|||||||.|.  |:..  :|..||.|: ..||.. 
  Fly   289 GLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAF--HEGV--WVLGGIVSF-GLNCGSR 348

  Fly   265 --ASVFTDVLSHAEFI 278
              .:|:|:|||:..:|
  Fly   349 FWPAVYTNVLSYETWI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/262 (30%)
Tryp_SPc 45..278 CDD:238113 78/261 (30%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 79/263 (30%)
Tryp_SPc 116..364 CDD:214473 78/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.