DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:72/270 - (26%)
Similarity:114/270 - (42%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMV-FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHL 94
            |...::.|.    ||.||:.|.....|::| .|.|....:.||||:|.:..|||||||......:
  Fly    28 PVKDVKIQG----RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV 88

  Fly    95 VARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRDNIRP 157
            ....|...|.:.:          ..|.|.:|  .:|..|:.....|||:::|           .|
  Fly    89 TINYGASLRNQPQ----------YTHWVGSGNFVQHHHYNSGNLHNDISLIR-----------TP 132

  Fly   158 ICVVWDHRWRHYLDKIDL--------------LTATGWGKTQMESD-SDALQTLDIRRQPPDVCA 207
            ....|     |.::|::|              ..|:|||.|...|. .|.||.:|::......|:
  Fly   133 HVDFW-----HLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCS 192

  Fly   208 KFIGQTIAGNQFCAG-NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQKA--SVF 268
            :  ..::..|..|.. |...:.|.|||||||   :||:..:   .||:.|: ::..||..  :||
  Fly   193 R--SWSLHDNMICINTNGGKSTCGGDSGGPL---VTHEGNR---LVGVTSFVSSAGCQSGAPAVF 249

  Fly   269 TDVLSHAEFI 278
            :.|..:.::|
  Fly   250 SRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/255 (27%)
Tryp_SPc 45..278 CDD:238113 68/254 (27%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 69/255 (27%)
Tryp_SPc 38..262 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.