DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG9733

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:284 Identity:83/284 - (29%)
Similarity:123/284 - (43%) Gaps:66/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PAC---GIRTQSRTAYRIINGHTAKYNSSPWMVFLH---------STTDMFVCGGSLITDKLVLT 83
            |:|   |||.      ||.:|.....|..||||.|.         ||    .|.||||..:.|||
  Fly   151 PSCGGVGIRN------RIYDGQDTDVNEFPWMVLLEYRRRSGNGLST----ACAGSLINRRYVLT 205

  Fly    84 AAHCFIANQH-----LVA-RLGEYERTRSEECT--GYYCNFREEHMVDAGFK----HKLYD--PN 134
            ||||......     ||: ||||::...:.:|.  |..|:...:.:   ||:    |:.|.  .:
  Fly   206 AAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRL---GFEEIRVHERYSEKAS 267

  Fly   135 THANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL--------LTATGWGKTQMESDSD 191
            ...:||.::|:.::|.|.|||:|||:.         ..:.|        .|..|||:|...:.|.
  Fly   268 NQVHDIGLIRMERNVRYSDNIQPICLP---------SSVGLESRQSGQQFTVAGWGRTLKMARSA 323

  Fly   192 ALQTLDIRRQPPDVCAKFIGQ---TIAGNQFCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQV 252
            ..|.:.:....|..|.:...|   .:...|.|| |.:..:.|:|||||||    .....:.:|..
  Fly   324 VKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPL----MRFRDESWVLE 384

  Fly   253 GIASYTNRNCQK--ASVFTDVLSH 274
            ||.|:..:...|  ..|:|:|.::
  Fly   385 GIVSFGYKCGLKDWPGVYTNVAAY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/268 (29%)
Tryp_SPc 45..278 CDD:238113 77/267 (29%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 78/268 (29%)
Tryp_SPc 162..415 CDD:238113 77/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.