DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:257 Identity:69/257 - (26%)
Similarity:112/257 - (43%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWM--VFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            ||.||:.|.....|::  |.|:|..:.:.||||:|....|||||||               ...:
  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHC---------------TAGA 89

  Fly   107 EECTGYY--CNFREEHMVDAGFKHKLYDPN----TH----ANDIAILRLSK----SVVYRDNIRP 157
            :|.:.||  .|:.|     ..|:|.:...|    .|    .:|:|:::...    |:|.:..:..
  Fly    90 DEASLYYGAVNYNE-----PAFRHTVSSENFIRYPHYVGLDHDLALIKTPHVDFYSLVNKIELPS 149

  Fly   158 ICVVWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIG-QTIAGNQFC 220
            :    |.|:..|  :.:.:.|.|||.....|: .:.|:.:|::......|..:.| .|.:.|..|
  Fly   150 L----DDRYNSY--ENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTIC 208

  Fly   221 AGNWDSN-LCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR-NCQKA--SVFTDVLSHAEFI 278
            ....|.. .|.|||||||   :|.:..:   .:||.|:.:. .||..  :.||.|..:.|:|
  Fly   209 VETPDGKATCQGDSGGPL---VTKEGDK---LIGITSFVSAYGCQVGGPAGFTRVTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/255 (27%)
Tryp_SPc 45..278 CDD:238113 67/254 (26%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 68/255 (27%)
Tryp_SPc 41..266 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.