DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:255 Identity:72/255 - (28%)
Similarity:109/255 - (42%) Gaps:52/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMV-FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSE 107
            ||.||:.|.....|::| .|.|....:.||||:|.:..|||||||......:....|...||:.:
  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQ 99

  Fly   108 ECTGYYCNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSK----SVV-------YRDNIRPIC 159
                      ..|.|.:|  .:|..|:.....|||:::|...    |:|       |.|..:...
  Fly   100 ----------YTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYA 154

  Fly   160 VVWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGN 223
            ..|             ..|:|||.|...|. .|.||::|::......|::  ..::..|..|. |
  Fly   155 GWW-------------AVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSR--TWSLHDNMICI-N 203

  Fly   224 WD--SNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQKA--SVFTDVLSHAEFI 278
            .|  .:.|.|||||||   :||...:   .||:.|: :...||..  :||:.|..:.::|
  Fly   204 TDGGKSTCGGDSGGPL---VTHDGNR---LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/253 (28%)
Tryp_SPc 45..278 CDD:238113 70/252 (28%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 71/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.