DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG11843

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:281 Identity:82/281 - (29%)
Similarity:124/281 - (44%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLDPACGIRTQSRTAYR-----IINGHTAKYNSSPWMVFL------HSTTDMFVCGGSLITDKLV 81
            ||.|...|.::.....|     |:.||.|:....|.|..|      .|..|.| |||.||:::.|
  Fly    46 FLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWF-CGGVLISERFV 109

  Fly    82 LTAAHCFIA--NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILR 144
            ||||||..:  .:..|.||||.:....:|...     ..::||.....|..|:.....:||.:::
  Fly   110 LTAAHCLESERGEVNVVRLGELDFDSLDEDAA-----PRDYMVAGYIAHPGYEDPQFYHDIGLVK 169

  Fly   145 LSKSVVYRDNIRPICVVW-DHRWRHYLDKIDLLTATGWGKTQME-SDSDALQTLDIRRQPPDVCA 207
            |:::||:.....|.|:.: |.|      ..|...|.|||.|.:. ..|..|..:.::|....||.
  Fly   170 LTEAVVFDLYKHPACLPFQDER------SSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCK 228

  Fly   208 KFIGQTI--------AGNQFCAGN-WDSNLCNGDSGGPLGAVITHKNTQ-RFVQVGIASYTNRNC 262
            |.:.:.:        ..||.|.|: ...:.|||||||||  ::.|:... .:|.|||.| ...:|
  Fly   229 KLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPL--LMYHREYPCMYVVVGITS-AGLSC 290

  Fly   263 QK---ASVFTDVLSHAEFILR 280
            ..   ..::|.|..:..:|.|
  Fly   291 GSPGIPGIYTRVYPYLGWIAR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/261 (29%)
Tryp_SPc 45..278 CDD:238113 75/255 (29%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 77/259 (30%)
Tryp_SPc 68..309 CDD:214473 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.