DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG11841

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:305 Identity:84/305 - (27%)
Similarity:124/305 - (40%) Gaps:91/305 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFL-HSTTD---MFVCGGSLITDKLVLTAAHCFIANQH---LVARLGEYE 102
            |::|..|:....|:...| |..|:   .:.|||:||:::|||||||||. ::|   .|.||||.|
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFF-SEHGEVNVVRLGELE 135

  Fly   103 ---RTRSEECTGYYCNFREEHMVDAGFKH-KLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWD 163
               .|...|...:.....:.|   .||:: :||      |||.|::|.:.|.:.....|.|:.:|
  Fly   136 FDTDTDDAEPEDFGVLALKAH---PGFENPQLY------NDIGIVQLDREVKFNRYKHPACLPFD 191

  Fly   164 HRWRHYLDKIDLLTATGWG-------------KTQMESDSD-ALQTLDIRRQPPDVCAKFIGQTI 214
            ...:|     :...|.|||             |.|::...| .:.::|...:.|:          
  Fly   192 DGEQH-----ESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPN---------- 241

  Fly   215 AG----NQFCAGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQV-GIASYTNRNCQKASVFTDVLS 273
             |    :|.|.|:.|: :.||||||||:.|.  ||:......| ||.|                 
  Fly   242 -GYEPKSQLCIGSRDNKDTCNGDSGGPVLAY--HKDLACMYHVMGITS----------------- 286

  Fly   274 HAEFILRVWRMYGKGQTLPIPKKPPTTTRPPTW--WHTTRIPKQT 316
                         .|.|...|..|...||...:  |....:.|||
  Fly   287 -------------AGITCSTPDIPSAYTRVHYFLNWIKGELAKQT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/263 (28%)
Tryp_SPc 45..278 CDD:238113 74/263 (28%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 81/296 (27%)
Tryp_SPc 72..310 CDD:214473 80/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.