DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG5909

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:274 Identity:86/274 - (31%)
Similarity:137/274 - (50%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL-HSTTD--MFVCGGSLITDKL 80
            |||:|..:      ||    ::...::..|.||:....||:..| :...|  .|.||||||:::.
  Fly   114 QLLNSVTN------CG----NKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERH 168

  Fly    81 VLTAAHCFIANQHLVA-RLGEYERTRSEEC-----TGYYC-NFREEHMVDAGFKHKLYDPNTHAN 138
            :||||||.|....::| ||||::....|:|     |...| ...||:.::....|..|.....::
  Fly   169 ILTAAHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISH 233

  Fly   139 DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPP 203
            |:||::|.:.|..:.:|:|:|:..|.:.:. ||........|||.|:.|:.:..||...|.|:..
  Fly   234 DVAIIKLDRVVKEKSHIKPVCLPIDQKSQE-LDFDQSFFVAGWGGTEKETVATKLQQALITRKSL 297

  Fly   204 DVCAKFIGQ-TIAGNQFCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC--QK 264
            :.|.::..: .::.|..|| |....:.|.||||||:......|||.|.||.|:.|:..|.|  .:
  Fly   298 NECRQYYNKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQ 362

  Fly   265 ASVFTDVLSHAEFI 278
            ..||..|:....:|
  Fly   363 PGVFASVIDMLPWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 79/247 (32%)
Tryp_SPc 45..278 CDD:238113 79/246 (32%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 79/247 (32%)
Tryp_SPc 132..379 CDD:238113 80/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.