DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:309 Identity:82/309 - (26%)
Similarity:122/309 - (39%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPA---CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAH 86
            ||...|.|   ||.:...|:|.||:.|..|.....||.|.|....:.| ||.::|..:.:::|||
Mouse   433 CSDESDEAQCDCGWQPAWRSAGRIVGGVEAAPGEFPWQVSLRENHEHF-CGATIIGARWLVSAAH 496

  Fly    87 CF------------IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAND 139
            ||            ..:.||........|||.....                ||..||.:|...|
Mouse   497 CFNEFQDPAQWAAQAGSVHLSGSEASAVRTRVLRIA----------------KHPAYDADTADFD 545

  Fly   140 IAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWG--KTQMESDSDALQTLDIRRQP 202
            :|:|.|::.:.:...::|.|:   ....|..........:|||  |.......:.||...:....
Mouse   546 VAVLELARPLPFGRYVQPACL---PAATHVFPPGKKCLISGWGYLKEDFLVKPEVLQKATVELLD 607

  Fly   203 PDVCAKFIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA 265
            ..:|:...|.::.....|||..|..:  |.|||||||   :..:.:.||...||.|: ...|.:|
Mouse   608 QSLCSSLYGHSLTDRMVCAGYLDGKVDSCQGDSGGPL---VCEEPSGRFFLAGIVSW-GIGCAEA 668

  Fly   266 ---SVFTDVLSHAEFILRVWRMYGKGQTLP-IPKKPPTTTRPPTWWHTT 310
               .|:|.|....::||.|    .....:| :|...|....|.|.|.|:
Mouse   669 RRPGVYTRVTRLRDWILEV----TSAADMPVVPTATPAPATPSTPWPTS 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/252 (25%)
Tryp_SPc 45..278 CDD:238113 63/251 (25%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060 4/8 (50%)
Tryp_SPc 455..684 CDD:214473 64/252 (25%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.