DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and krt8.1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001002797.1 Gene:krt8.1 / 431676 XenbaseID:XB-GENE-876929 Length:508 Species:Xenopus tropicalis


Alignment Length:159 Identity:31/159 - (19%)
Similarity:60/159 - (37%) Gaps:25/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPAC-GIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTA-----AHC 87
            :||.. .:||:.:...:.:|...|.:...  :.||.....|.....||:.::....:     ...
 Frog    92 IDPTIQQVRTEEKEQIKTLNNKFASFIDK--VRFLEQQNKMLETKWSLLQNQKATRSNMDAMFEA 154

  Fly    88 FIAN-QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP-NTHA---NDIAILRLSK 147
            :|.| :..:..||: ::.|.|...|......|:      ||:|..|. |...   |:..:|:...
 Frog   155 YIGNLRRQLDGLGQ-DKMRLESELGNMQGLVED------FKNKYEDEINKRTELENEFVLLKKDV 212

  Fly   148 SVVYRDNIRPICVVWDHRWRHYLDKIDLL 176
            ...|.:.::     .:.|.....|:|:.|
 Frog   213 DEAYMNKVQ-----LEARLEALTDEINFL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 27/143 (19%)
Tryp_SPc 45..278 CDD:238113 27/142 (19%)
krt8.1NP_001002797.1 Keratin_2_head <63..99 CDD:374433 2/6 (33%)
Filament 102..413 CDD:365827 27/149 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.