DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and SPE

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:110/260 - (42%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWMVFLH-----STTDMFVCGGSLITDKLVLTAAHCFIANQ--------H 93
            |.||..|........||||.|.     |.|..|.|||:|:..:.||||.||..:.:        |
  Fly   132 ADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLH 196

  Fly    94 LVARLGEYERTRSEECTGYYCNFR---EEHM---VDAGFKHKLYDPNT--HANDIAILRLSKSVV 150
            .| ||||::.....:||......|   .:|:   |:.|..|::|.||:  ..||||::||.:.|.
  Fly   197 SV-RLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVS 260

  Fly   151 YRDNIRPICVVWDHRWRHYLDKIDL-LTATGWGKTQ-----------------MESDSDALQTLD 197
            |.|.:||||:..|...::  :.:|. :...|||.|:                 :.|..:...:..
  Fly   261 YTDYVRPICLPTDGLVQN--NFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFK 323

  Fly   198 IRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC 262
            ::.....:||             .|....:.|.|||||||...|:......|...|:.||..:.|
  Fly   324 VKLDDSQMCA-------------GGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPC 375

  Fly   263  262
              Fly   376  375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/258 (29%)
Tryp_SPc 45..278 CDD:238113 73/257 (28%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 73/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463529
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.