DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG16710

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:272 Identity:91/272 - (33%)
Similarity:130/272 - (47%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWM---VFLHSTTDMF------VCGGSLITDKLVLTAAHCF-IANQHL-V 95
            ||||..|...:.|..|||   ::.|.:..::      .|.|||||::.|||||||. |....| .
  Fly   103 AYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRR 167

  Fly    96 ARLGEYERTRSEECTGYYCNFRE----EHM---VDAGFKHK---LYDPNTHANDIAILRLSKSVV 150
            .||||:....:.:|. .:.|.||    ||:   ||...||:   :::...: ||||:|||...|.
  Fly   168 VRLGEHNILSNPDCV-THINGREHCAPEHLEIDVDLSIKHRHYMVFEERPY-NDIALLRLKFPVR 230

  Fly   151 YRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIA 215
            |...|:||||..|:.:.:.......|...|||.:..:..|:.|....:..:..|.|:  :.:...
  Fly   231 YTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECS--LSEPSL 293

  Fly   216 G----NQFCAGNWDSN-LCNGDSGGPLGAVITHKNTQRFVQV-GIASYTNRNC-QKASVFTDVLS 273
            |    ...||||...| .|.|||||||.|:: .:..:.||.: ||.||....| ...:.:|....
  Fly   294 GLDKETHICAGNLGGNDTCKGDSGGPLMAIM-ERGDEEFVYLAGITSYGYSQCGYGPAAYTKTSK 357

  Fly   274 HAEFILRVWRMY 285
            ..|:||  |.||
  Fly   358 FVEWIL--WNMY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 84/261 (32%)
Tryp_SPc 45..278 CDD:238113 83/260 (32%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 84/261 (32%)
Tryp_SPc 106..362 CDD:238113 83/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.