DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG31199

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:252 Identity:50/252 - (19%)
Similarity:80/252 - (31%) Gaps:84/252 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSLITDKLVLTAAHCFI----ANQHLVARLGEYERT-----RSEECTGYYCNFREEHMVDAGF 126
            |.|.|::.:.||..||||:    ..:.....||.:.::     |..|..||.....:|..:....
  Fly    71 CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIA 135

  Fly   127 KHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSD 191
            .|..||..|..|.:|:|.|.:......|:.|||:                               
  Fly   136 IHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICM------------------------------- 169

  Fly   192 ALQTLDIRRQPPDVCAK-FIGQT--IAG----NQFCAGNWDSNLCNGDSGGPLGAVITHKN---- 245
                     .||.:..: .:.||  :||    ..|....|.:.|..|.....:..::|..|    
  Fly   170 ---------PPPSLLNETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGFCQSKVKTLVTSSNTVCG 225

  Fly   246 -----------------------TQRFVQVGI-ASYTNRNCQKASVFTDVLSHAEFI 278
                                   ||.:..||| ..:...|.:..|.|..:.::.:||
  Fly   226 YHKQPVAYYLGAPLVGLQKKGHVTQNYYLVGIMIDWRWENNRIMSSFLAIRNYMDFI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 48/250 (19%)
Tryp_SPc 45..278 CDD:238113 48/250 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 43/225 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.