DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG31219

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:266 Identity:85/266 - (31%)
Similarity:130/266 - (48%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWM---VFLHSTTDMFV--CGGSLITDKLVLTAAHCFIA 90
            |:..|..||.:.||::.|..|:.|..|||   ::|::||...:  |.||||.::.|||:|||...
  Fly    75 PSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNG 139

  Fly    91 NQHLVA----RLGEYE-----------RTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN-- 138
            ....::    ||||::           |.:..:|.......:.|.::    .|.|:...::.|  
  Fly   140 IPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKII----VHGLFSSISNRNIE 200

  Fly   139 -DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQP 202
             |||:|||...|.||..|.|||:.     :|.......|...|||||.....|..|....||.:.
  Fly   201 YDIALLRLKMPVRYRTGIMPICIP-----KHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERS 260

  Fly   203 PDVCA-KF----IGQTIAGNQFCAGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN 261
            ..||| :|    :.|::   |.|||.:|. :.|.|||||||  ::|..|:..:: .||.:|.::|
  Fly   261 IAVCALRFPYLDLNQSL---QICAGGYDGVDTCQGDSGGPL--MVTMDNSSVYL-AGITTYGSKN 319

  Fly   262 CQKASV 267
            |.:..:
  Fly   320 CGQIGI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 80/253 (32%)
Tryp_SPc 45..278 CDD:238113 79/252 (31%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 80/253 (32%)
Tryp_SPc 90..342 CDD:238113 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.