DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG5255

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:240 Identity:68/240 - (28%)
Similarity:98/240 - (40%) Gaps:63/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL-------HSTTDMFVCGGSLITDKL 80
            |..||.|.|      ...|..||:.|..|....:|:.:.|       ||      |||::|.::.
  Fly    14 SAASQILYP------PQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHS------CGGAIIDERW 66

  Fly    81 VLTAAHCFIANQHLVARLGEYERTRSEECTGY---------YCNFREEHMVDAGFKHKLYDPNTH 136
            ::|||||                ||..:.|.:         :.|..:.:..|...:|..|.|..:
  Fly    67 IITAAHC----------------TRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKY 115

  Fly   137 ANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDA-LQTLDIRR 200
            .||||:|.|::|:|:.:..:|  |..||   ..|.....|..||||...:..|..| ||:|::..
  Fly   116 RNDIALLHLNESIVFDNATQP--VELDH---EALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNY 175

  Fly   201 QPPDVCAKF--------IGQTIAGNQFCAGNWDSNLCNGDSGGPL 237
            .|.:.|...        ||.....|....|     .|:|||||||
  Fly   176 VPFEQCRAAHDNSTRVDIGHVCTFNDKGRG-----ACHGDSGGPL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/219 (28%)
Tryp_SPc 45..278 CDD:238113 61/218 (28%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 62/219 (28%)
Tryp_SPc 30..252 CDD:238113 61/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.