DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG5246

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:209 Identity:67/209 - (32%)
Similarity:95/209 - (45%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF-IANQHLVARLGEYERTRSE 107
            |:|.|..:....:|:.|.:.:|....|||||:|..:.:||||||. ...|:|....|..:.||. 
  Fly    41 RVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRP- 104

  Fly   108 ECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDK 172
                     ..|::||....|..:|...:.||||::..:|.:||.|..:||.:.    .:..|.|
  Fly   105 ---------GAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLA----SKGSLPK 156

  Fly   173 I-DLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDS--------- 226
            : |.||.||||.|:.... |..||.:|:.....|.|     |:...|    .||.|         
  Fly   157 VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNC-----QSRVRN----ANWLSEGHVCTFTQ 212

  Fly   227 ---NLCNGDSGGPL 237
               ..|:|||||||
  Fly   213 EGEGSCHGDSGGPL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/209 (32%)
Tryp_SPc 45..278 CDD:238113 66/208 (32%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/209 (32%)
Tryp_SPc 42..263 CDD:238113 66/208 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.