DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG4053

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:267 Identity:68/267 - (25%)
Similarity:112/267 - (41%) Gaps:58/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLHSGCSQFLDPACGIRTQSRTAY--RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVL 82
            ||..|.|  :|...|.|..:|...  ||:.|..|:...:|:.|.:.:.....:|.|.::.::.:|
  Fly    10 LLLLGTS--IDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWIL 72

  Fly    83 TAAHCFI--ANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYD-PNTHANDIAILR 144
            ||.||.:  :.:.|...:|..:|....:..     |.:|.:|     |.||| |..:.||||::.
  Fly    73 TAGHCALDFSIEDLRIIVGTNDRLEPGQTL-----FPDEALV-----HCLYDIPYVYNNDIALIH 127

  Fly   145 LSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS-DALQTLDIRRQPPDVCAK 208
            :::|:::.|..:.:     ...|........:|.||||..:....: ..||||::          
  Fly   128 VNESIIFNDRTQIV-----ELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNL---------- 177

  Fly   209 FIGQTIAGNQFCAGNWD-----------------SNLCNGDSGGPL---GAVITHKNTQRFVQVG 253
                ||..::.|...||                 ...|:|||||||   |.::...|..|...||
  Fly   178 ----TIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGVG 238

  Fly   254 IAS-YTN 259
            :.. |.|
  Fly   239 MPDMYAN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 60/241 (25%)
Tryp_SPc 45..278 CDD:238113 59/240 (25%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 60/241 (25%)
Tryp_SPc 35..256 CDD:238113 59/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.