DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG17475

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:254 Identity:64/254 - (25%)
Similarity:101/254 - (39%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIAN 91
            :::..|.|:..|:    |:|||...:...:.:.:.|.......:|||.:|.::.|||||||....
  Fly    36 EWISKAEGVNFQN----RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGY 96

  Fly    92 Q----HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYR 152
            .    .::....|||:..:       ..|.|||.:...:.    .|:.| ||||::||:.::   
  Fly    97 NPTYLRVITGTVEYEKPDA-------VYFVEEHWIHCNYN----SPDYH-NDIALIRLNDTI--- 146

  Fly   153 DNIRPICVVWDHRWRHYLDKIDLLTA----------TGWGKTQMESDS-DALQTLDIRRQPPDVC 206
                        ::..|....:|.||          ||||.|::..|: |.||...:.......|
  Fly   147 ------------KFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTC 199

  Fly   207 AKFIGQTIAGNQFCAG--------NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
                 |.|..|....|        ......|:|||||||    ||..    |..|:.::
  Fly   200 -----QEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL----THNG----VLYGLVNW 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 61/237 (26%)
Tryp_SPc 45..278 CDD:238113 60/236 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 61/237 (26%)
Tryp_SPc 50..269 CDD:238113 60/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.