DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and modSP

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:117/294 - (39%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL---HSTTDM-FVCGGSLITDK 79
            |.....|.|...|   |:..|...|.|.|      ...||.|.|   |:..|. |.|||||:|..
  Fly   352 QRCEQDCGQLATP---IKQFSSGGYTINN------TVVPWHVGLYVWHNEKDYHFQCGGSLLTPD 407

  Fly    80 LVLTAAHC-----------FIANQHLVARL-GEYERTRSEECTGYYCNFREEHMVD--AGFKHKL 130
            ||:|||||           :...:.:.|:. ..|..|..||      ..|:..:::  .|:|.: 
  Fly   408 LVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEE------KRRDVRLIEIAPGYKGR- 465

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLL-----TATGWGKTQMESDS 190
              ...:..|:|:|.|.:.......||||||.    :..:.:|..:.     ...||   .:|:..
  Fly   466 --TENYYQDLALLTLDEPFELSHVIRPICVT----FASFAEKESVTDDVQGKFAGW---NIENKH 521

  Fly   191 DALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNL-CNGDSGG------PLGAVITHKNTQR 248
            : ||.:....:...||.:.: :.|..::||......:| |.|||||      |..|..|. ||.|
  Fly   522 E-LQFVPAVSKSNSVCRRNL-RDIQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTW-NTAR 583

  Fly   249 FVQVGIASYTNRNCQKA---SVFTDVLSHAEFIL 279
            ....|:.|......|.|   :|.|::....:.||
  Fly   584 HFLFGVISNAPNADQCAHSLTVMTNIQHFEDMIL 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/266 (26%)
Tryp_SPc 45..278 CDD:238113 70/265 (26%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 1/1 (100%)
Tryp_SPc 371..616 CDD:214473 71/269 (26%)
Tryp_SPc 371..591 CDD:304450 66/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.