DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG31326

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:289 Identity:81/289 - (28%)
Similarity:125/289 - (43%) Gaps:71/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFL----HSTTDMFVCGGSLITDKLVLTAAHCF----- 88
            || |.::.|...|..|.:.:....||:|.:    .|....|:|||:||:...||:|||||     
  Fly   263 CG-RERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGR 326

  Fly    89 -IANQHLVARLGEYERTRSEECTGYYCNFR--EEHMVDAGFKHKLYDPNTHANDIAILRLSKSVV 150
             :....|...||  ..|.:....|   .||  .:.::...|:.|.:   |.| |:|::||.:.|.
  Fly   327 DLPASRLAVSLG--RNTLAIHSDG---EFRGVSQLIIHENFQFKQF---TEA-DLALVRLDEPVR 382

  Fly   151 YRDNIRPICVVWDHRWRHYLDKIDLLTA------------TGWGKTQMESDSD---------ALQ 194
            |.|.|.||| :|...     :::||...            ||.|.|::...:|         ||:
  Fly   383 YTDYIVPIC-LWSTS-----NRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALE 441

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNT---QRFVQVGIAS 256
            ...:..||..:|||..|         ||.     |..|.||||  ::..::.   :..:..|:.:
  Fly   442 LPHVLVQPSSLCAKKTG---------AGP-----CASDGGGPL--MLREQDVWVLRGVISGGVIN 490

  Fly   257 YTNRNCQ--KASVFTDVLSHAEFI-LRVW 282
            .....|:  |.||||||..|.|:: .::|
  Fly   491 EKENTCELSKPSVFTDVAKHIEWVRQKMW 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/271 (28%)
Tryp_SPc 45..278 CDD:238113 76/270 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 75/270 (28%)
Tryp_SPc 277..514 CDD:214473 75/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.