DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG11670

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:239 Identity:66/239 - (27%)
Similarity:110/239 - (46%) Gaps:34/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FVCGGSLITDKLVLTAAHCFIAN--QHLVARLGEYERTRSEECTGYYCNFR-EEHMVDAGFKHKL 130
            :.||||||:::.|||||||...:  ...:.::|:.:....|      .|.. :...|...:.|.|
  Fly   198 YKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWE------LNVAPQRRRVAQIYLHPL 256

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQM-ESDSDALQ 194
            |:.:.:.:||.:::|::.|.|...:||: .:|......|    ..|...|:|.|.. :..::.|.
  Fly   257 YNASLNYHDIGLIQLNRPVEYTWFVRPV-RLWPMNDIPY----GKLHTMGYGSTGFAQPQTNILT 316

  Fly   195 TLDIRRQPPDVCAKFI------GQTIAGNQFCAGNWDSN--LCNGDSGGPLGAVI-------THK 244
            .||:...|.:.|...:      ...:..:|.||.:::.|  .|.|||||||...:       |.:
  Fly   317 ELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSR 381

  Fly   245 NTQRFVQVGIASYTNRNCQK--ASVFTDVLSHAEFILR-VWRMY 285
            ...|:..|||.|| ...|:.  ..|:|.|.|:.::|.. ||..|
  Fly   382 KHYRYYLVGITSY-GAYCRSELPGVYTRVSSYIDWIASIVWPNY 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/229 (27%)
Tryp_SPc 45..278 CDD:238113 62/229 (27%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.