DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG11668

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:299 Identity:70/299 - (23%)
Similarity:125/299 - (41%) Gaps:76/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL------------HSTTD---MFVCGGSLI 76
            :.::|......||:..  ::.|...:.|..|:|..|            |.::.   .|.||.::|
  Fly   132 ELVEPIIQKHNQSQNL--LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMI 194

  Fly    77 TDKLVLTAAHCFI--ANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTHA 137
            ..:..:|||||..  .....||.:|           |...|.....:::..  .:|..:|..|..
  Fly   195 APRFAITAAHCASVGGESPSVALIG-----------GVELNSGRGQLIEIKRISQHPHFDAETLT 248

  Fly   138 NDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL----LTATGWGKTQMES--DSDALQT- 195
            ||:|:::|:     |.:..|:..:|:..        .|    |||.|:|:|:...  .|:.||. 
  Fly   249 NDLAVVKLA-----RRSHMPVACLWNQE--------SLPERPLTALGYGQTKFAGPHSSNLLQIM 300

  Fly   196 ---LDIRRQPPDVCAKF------IGQTIAGNQFCAGNWDSNL--CNGDSGGPL---GAVITHKNT 246
               |:.::     |.::      :...:...|.|||::..|:  |.|||||||   ..:..|::|
  Fly   301 LYHLNFQQ-----CQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHT 360

  Fly   247 QRFVQVGIASYTNRNCQ--KASVFTDVLSHAEFI-LRVW 282
            ..:| |||.|:... |.  :..|:..:..:.::| .:||
  Fly   361 IPYV-VGITSFGGA-CASGQPGVYVRIAHYIQWIEQQVW 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/275 (23%)
Tryp_SPc 45..278 CDD:238113 64/274 (23%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 65/276 (24%)
Tryp_SPc 149..392 CDD:214473 64/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.