DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG12951

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:102/266 - (38%) Gaps:68/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            |::||..:.....|::|.|.|......||||:|:...|:|||||                |....
  Fly    29 RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC----------------TNGRP 77

  Fly   109 CTGYYCNFREEHMVDAG---------FKHKLYDP-NTHANDIAILRLSKSVVYRD-NIRPICVVW 162
            .......|...::...|         .:|:.:|| ..:||||::|.:.:...:.. ::.|:    
  Fly    78 ADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPV---- 138

  Fly   163 DHRWRHYLDKIDLL-------------TATGWG-KTQMESDSDALQTLDIRRQPPDVC-AKFIGQ 212
                     ::..|             ...||| .....|..|.||.:.::....:.| ::..||
  Fly   139 ---------ELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQ 194

  Fly   213 TIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDVL 272
            |......|.|  ......|:|||||||     ..|.|   ||||.|::.:.|..|   .|:..|.
  Fly   195 TDPKYHICGGVDEGGKGQCSGDSGGPL-----IYNGQ---QVGIVSWSIKPCTVAPYPGVYCKVS 251

  Fly   273 SHAEFI 278
            .:.::|
  Fly   252 QYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 63/264 (24%)
Tryp_SPc 45..278 CDD:238113 62/263 (24%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 63/264 (24%)
Tryp_SPc 30..260 CDD:238113 63/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
11.000

Return to query results.
Submit another query.