DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Sp7

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:276 Identity:90/276 - (32%)
Similarity:131/276 - (47%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM----FVCGGSLITDKLVLTAAHCFIAN 91
            |.||..:.|...|   ||:....:...||..|....:.    ..||||||.::.|||||||.|..
  Fly   126 PKCGPHSFSNKVY---NGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGA 187

  Fly    92 -----QHL-VARLGEYERTRSEECTGYYCNFREEHMVDAGFK----HKLYDP--NTHANDIAILR 144
                 .|| ..|||||:.::..:|....||   :.::..|.:    |..|||  ....:|||:||
  Fly   188 VETEVGHLTTVRLGEYDTSKDVDCIDDICN---QPILQLGIEQATVHPQYDPANKNRIHDIALLR 249

  Fly   145 LSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCA-K 208
            |.:.||..:.|:|:|:..... |..::..:||..:|||:|.....|...|.||:.....|.|| |
  Fly   250 LDRPVVLNEYIQPVCLPLVST-RMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDHDYCARK 313

  Fly   209 FIGQTI--AGNQFC-AGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK---ASV 267
            |..:.|  ..:|.| .|.:..:.|:|||||||   :.....|.:.|.|:.|:.|| |..   ..|
  Fly   314 FATRNIHLISSQLCVGGEFYRDSCDGDSGGPL---MRRGFDQAWYQEGVVSFGNR-CGLEGWPGV 374

  Fly   268 FTDVLSHAEFILRVWR 283
            :|.|..:.::|:...|
  Fly   375 YTRVADYMDWIVETIR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 83/256 (32%)
Tryp_SPc 45..278 CDD:238113 83/255 (33%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 84/259 (32%)
Tryp_SPc 137..388 CDD:238113 85/261 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.