DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss45

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:325 Identity:82/325 - (25%)
Similarity:133/325 - (40%) Gaps:57/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPT-FVGIILMFQLLHSGCSQ-FLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFV 70
            :|| |..::|:....:.|.:: ..:|.||....|.:        ..:.:..||.|.|....: .|
  Rat    19 IPTCFAALLLLPPRPNLGYNEDHAEPVCGAPWWSDS--------LEERHHWPWEVSLQIENE-HV 74

  Fly    71 CGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNT 135
            |||:||....|::||||...|:..:..||  ..|.....:.:....   .:.|.....|.:..|.
  Rat    75 CGGALIDQSWVVSAAHCIQGNKEYLVMLG--SSTLQPSGSPWALKI---PVGDIIMHPKYWGQNF 134

  Fly   136 HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL-LTATGWGKTQMESDSDALQTLDIR 199
            ..:|||:|.|...|.:...|:|||:. :|.:..   |:.: ...||||:.:....:...::|::.
  Rat   135 IRSDIALLCLETPVTFNKYIQPICLP-EHNFNL---KVGMKCWVTGWGQAKQHPSAKLTRSLELW 195

  Fly   200 RQPPDV-----CAK------FIGQT---IAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFV 250
            .....:     |.:      |..|.   |..|..|..|...|.|.||.||||...: |   .|::
  Rat   196 EAEVSIVDNKNCDRVFHKKTFYPQVIPLIRKNMICTTNHRENPCYGDPGGPLACEV-H---GRWI 256

  Fly   251 QVGIASYTNRNCQKA---SVFTDVLSHAEFIL-RVWRMYGKGQ-------------TLPIPKKPP 298
            ..||.|: .:.|.||   ||:|.:..:..:|. :|.|....|:             .||:...||
  Rat   257 LAGIFSW-EKACTKAPNLSVYTRIDKYTGWIKEQVSRGARSGRCRTSCLLFLPWLLQLPVSPGPP 320

  Fly   299  298
              Rat   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/251 (26%)
Tryp_SPc 45..278 CDD:238113 65/250 (26%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 66/246 (27%)
Tryp_SPc 57..286 CDD:214473 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.