DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:284 Identity:77/284 - (27%)
Similarity:125/284 - (44%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LMFQLLHS------GCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGS 74
            :::|.|.|      ..|.|....||.||.:...:::..|..|:....||...|.. .::..||.:
  Rat   152 ILYQKLKSQTRLLIDSSSFKFSGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQ-NNVHRCGAT 215

  Fly    75 LITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNF-------REEHMVDAGFKHKLYD 132
            ||::..::||||||:               ||.....:..:|       :.:..|.:...|:.|.
  Rat   216 LISNSWLITAAHCFV---------------RSANPKDWKVSFGFLLSKPQAQRAVKSIVIHENYS 265

  Fly   133 PNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS-DALQTL 196
            ...|.||||::|||..|:|.:|||..|:  ....:.:....|:: .||||..:.:.|| :.||..
  Rat   266 YPAHNNDIAVVRLSSPVLYENNIRRACL--PEATQKFPPNSDVV-VTGWGTLKSDGDSPNILQKG 327

  Fly   197 DIRRQPPDVC--AKFIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            .::......|  .|..|..|.....|||..:..:  |.|||||||   ::..:...:...||.|:
  Rat   328 RVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGGPL---VSEDSKGIWFLAGIVSW 389

  Fly   258 TNRNC---QKASVFTDVLSHAEFI 278
            .: .|   .|..|:|.|..:.::|
  Rat   390 GD-ECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/248 (27%)
Tryp_SPc 45..278 CDD:238113 67/247 (27%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699 1/4 (25%)
Tryp_SPc 186..412 CDD:214473 67/248 (27%)
Tryp_SPc 187..415 CDD:238113 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.