DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk4

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:244 Identity:68/244 - (27%)
Similarity:105/244 - (43%) Gaps:51/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYER 103
            |..:.|||.|.....:|.||...|.|..:.|.|.|.|:..:.||:|||| |.:.:.|. ||.:..
  Rat    26 SSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHC-IQDSYTVG-LGLHNL 88

  Fly   104 TRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI---------- 158
            ..|:|...   ...|.|:   ..:|..|:..:.|||:.:::|::||:..:.||.|          
  Rat    89 EGSQEPGS---RMLEAHL---SIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVASQCPTPG 147

  Fly   159 --CVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCA 221
              |:|                 :|||:.:.......||.:::.....:.|..........:.|||
  Rat   148 DTCLV-----------------SGWGRLKNGKLPSLLQCVNLSVASEETCRLLYDPVYHLSMFCA 195

  Fly   222 GNWD--SNLCNGDSGGPLGAVITHKNTQRFV--------QVGIAS-YTN 259
            |...  .:.||||||||   ::.:::.|..|        |.||.| |||
  Rat   196 GGGPDRKDTCNGDSGGP---IVCNRSLQGLVSMGQGECGQPGIPSVYTN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/239 (28%)
Tryp_SPc 45..278 CDD:238113 66/238 (28%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.