DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tryx5

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:261 Identity:61/261 - (23%)
Similarity:92/261 - (35%) Gaps:88/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYE---RTRSEECTGYYCNFRE 118
            |:|.:|.|:.:  .|.|:||....|||||||.:..:   .|||.|.   :...|:..||      
  Rat    39 PYMAYLKSSPE--PCVGTLIDPLWVLTAAHCSLPTK---IRLGVYRPNIKNEKEQIHGY------ 92

  Fly   119 EHMVDAGFKHKLYDPNTHANDIAILRLS----------------KSVVYRDNIRPICVVWDHRWR 167
                .....|..:|.|...||:.:::||                :.:|:.:.    |.:....|.
  Rat    93 ----SLTVVHPNFDANIRKNDLMLIKLSYPATIDMYVGTIAIAMEPMVFNET----CFIPTWTWN 149

  Fly   168 HYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTI----------AGNQFCAG 222
            ||.:..|..|.| |......|.||...||..:||...:....||.:.          |....|:|
  Rat   150 HYNNYSDPDTLT-WTNQYSRSPSDCWNTLHQQRQETRINIMCIGHSFNVKSSTKEVSAAPAICSG 213

  Fly   223 ------NW-DSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILR 280
                  :| .:.:.||..|                                .||::..:|.:|||
  Rat   214 RVHGILSWGKAGITNGSEG--------------------------------FFTEIHPYARWILR 246

  Fly   281 V 281
            |
  Rat   247 V 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 57/256 (22%)
Tryp_SPc 45..278 CDD:238113 57/256 (22%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.