DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and prss29

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:271 Identity:75/271 - (27%)
Similarity:111/271 - (40%) Gaps:70/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLVARLGEYERTRS 106
            ||:.|..::....||.:.|..... |:|||||:||..||||||||  :......|.||.|:.:..
 Frog    25 RIVGGTDSEEGEWPWQISLEFEGG-FLCGGSLLTDSWVLTAAHCFDSMNVSKYTAYLGVYQLSDL 88

  Fly   107 EECTGYYCNFREEHMVDAGFK----HKLYDPNTHANDIAILRLSKSVVYRDNIRPIC-------- 159
                        ::.|..|.|    |..|.....:.|||::.|.:.:|:..:|:|:|        
 Frog    89 ------------DNAVLRGVKNITVHPDYMYEGSSGDIALIELEEPIVFTPSIQPVCLPSQDVPL 141

  Fly   160 ----VVWDHRWRHYLDKIDLLTATGWG----KTQMESDSDALQTLDI----RRQPPDVCAKFIG- 211
                :.|               .||||    .|.:| |...||..::    |.....:....:| 
 Frog   142 PMGTMCW---------------VTGWGNIKENTPLE-DPQTLQKAEVGLINRTSCEAMYQSSLGY 190

  Fly   212 ----QTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASV 267
                ..|..:..|||.....:  |.|||||||  |....||  ::|.||.|: ...|   .:..|
 Frog   191 RPSIHLIQDDMICAGYKQGKIDACQGDSGGPL--VCNTSNT--WLQFGIVSW-GLGCAEPNQPGV 250

  Fly   268 FTDVLSHAEFI 278
            :|:|..:..:|
 Frog   251 YTNVQYYLTWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/269 (28%)
Tryp_SPc 45..278 CDD:238113 73/268 (27%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 74/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.