DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG9372

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:268 Identity:85/268 - (31%)
Similarity:120/268 - (44%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFV-CGGSLITDKLVLTAAHCFIA--NQHL 94
            |||  .||...|:..|..|:.:..|||..|......|| |||.||||:.|||||||...  .:.:
  Fly   164 CGI--TSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDI 226

  Fly    95 VARLGEY-----ERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDN 154
            ..|||||     ..||:.:       ||..:||    .|..|:|..:.|||||:|:.::.::...
  Fly   227 FVRLGEYNTHMLNETRARD-------FRIANMV----LHIDYNPQNYDNDIAIVRIDRATIFNTY 280

  Fly   155 IRPICVV-----WDHRWRHYLDKIDLLTATGWGKTQMES-DSDALQTLDIRRQPPDVCAKFIGQT 213
            |.|:|:.     |..|         ....||||..:... .|:.|..:::.......|.....|.
  Fly   281 IWPVCMPPVNEDWSDR---------NAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQH 336

  Fly   214 IAGNQFCA----GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDV 271
            :.....||    |..||  |.|||||||   :.....||:|.:||.|: ...|   .:..::|.|
  Fly   337 VPDTAMCAGFPEGGQDS--CQGDSGGPL---LVQLPNQRWVTIGIVSW-GVGCGQRGRPGIYTRV 395

  Fly   272 LSHAEFIL 279
            ..:.::||
  Fly   396 DRYLDWIL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/254 (31%)
Tryp_SPc 45..278 CDD:238113 77/253 (30%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 78/254 (31%)
Tryp_SPc 176..402 CDD:238113 77/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.