DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG14088

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:328 Identity:93/328 - (28%)
Similarity:150/328 - (45%) Gaps:46/328 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65
            ||:.|..|.....:::.  |..:|.:|||...||.|....:...:          .||...||. 
  Fly     1 MHSELEIVAVLTSLLIF--LSGTGSAQFLGNICGERRDGLSPDIV----------GPWTAILHH- 52

  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            ....|..|:||.::.:||..||..:...:.||||||.|..||        ..|:|:|.|.|.:..
  Fly    53 FGRIVGVGTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSE--------LAEDHIVAAFFSNAN 109

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQ 194
            ::|.|.||::.:::|.::|||:::|.|:|::.|.|.:.:.|::|....|.|    ..|| |..|:
  Fly   110 FNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTW----KNSDKSPMLR 170

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN 259
            :..:.|. |..|.|     :...|||||:.|.:.|:..||..|...|.:....|.|..|||:...
  Fly   171 SKTVIRM-PQACGK-----LDHGQFCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVE 229

  Fly   260 RNCQKASVFTDVLSHAEFILRVWRMYGKGQTLPIPKKPPTTTRPPTWWHTTRIPKQTFQ--DYDY 322
            ..|..:..:|||:...::|..|  :|.......:.|.          .:||.:|:..|:  ...:
  Fly   230 VKCSNSRTYTDVVQLHQWISMV--IYSSNTNDGMDKP----------HNTTHLPEPVFELKSTSF 282

  Fly   323 DTN 325
            .||
  Fly   283 STN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/234 (30%)
Tryp_SPc 45..278 CDD:238113 71/233 (30%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 72/237 (30%)
Tryp_SPc 42..248 CDD:214473 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.