DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and PRSS57

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:293 Identity:80/293 - (27%)
Similarity:114/293 - (38%) Gaps:78/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFL-----HSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR-----L 98
            :||.||....:|.|:|..:     |.      |||.|:..:.|::|||||   .|...|     |
Human    33 QIIGGHEVTPHSRPYMASVRFGGQHH------CGGFLLRARWVVSAAHCF---SHRDLRTGLVVL 88

  Fly    99 GEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNI-------- 155
            |.:..:.:|..       ::...:||...|..|.|.||||||.:|||:.|.|....:        
Human    89 GAHVLSTAEPT-------QQVFGIDALTTHPDYHPMTHANDICLLRLNGSAVLGPAVGLLRPPGR 146

  Fly   156 --RP-----ICVVWDHRWRHYLDKIDLLTATGWG-KTQMESDSDALQTLDIRRQPPDVCAKFIGQ 212
              ||     .|.|                 .||| .:..|.....|....:|...||||......
Human   147 RARPPTAGTRCRV-----------------AGWGFVSDFEELPPGLMEAKVRVLDPDVCNSSWKG 194

  Fly   213 TIAGNQFCAGNWDSN---LCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDV 271
            .:.....|..:.||:   .|:.||||||    ..:|...    |:.|::...|   :...|:|.|
Human   195 HLTLTMLCTRSGDSHRRGFCSADSGGPL----VCRNRAH----GLVSFSGLWCGDPKTPDVYTQV 251

  Fly   272 LSHAEFILRVWRMYGKGQTLPIPKKPPTTTRPP 304
               :.|:..:|.:..:..  |.|...|.|||||
Human   252 ---SAFVAWIWDVVRRSS--PQPGPLPGTTRPP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/265 (26%)
Tryp_SPc 45..278 CDD:238113 70/264 (27%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 71/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.