DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG6865

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:317 Identity:81/317 - (25%)
Similarity:127/317 - (40%) Gaps:88/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGCSQ--FLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGS 74
            |.::.:..|:....||  |.:..|.:|..     :|:.|..|:.|..|:||.|......| |||:
  Fly     5 VFVVAVLSLVKCAQSQIAFSNQPCSVRNP-----KIVGGSEAERNEMPYMVSLMRRGGHF-CGGT 63

  Fly    75 LITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDA--------------- 124
            :|:::.:|||.||.                         ||..::.|..|               
  Fly    64 IISERWILTAGHCI-------------------------CNGLQQFMKPAQIQGVVGLHSIREYL 103

  Fly   125 ------------GFK----HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI 173
                        .||    |..||.|...:|||:|.|.:.:.:..:|:|.||..:...|....:.
  Fly   104 NGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEY 168

  Fly   174 DLLTATGWGKT---QMESD-SDALQTLDIRRQPPDVCA---KFIGQ--TIAGNQFCAG--NWDSN 227
            .  |.:|||.|   |.|:| ||.|:...::....:.|.   :.:|:  ||...|.|||  |...:
  Fly   169 G--TVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQID 231

  Fly   228 LCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFILRV 281
            .|..||||||.:...|       .||:.| |...|.:   ..::|.|..:..::.:|
  Fly   232 SCWADSGGPLMSKEHH-------LVGVVS-TGIGCARPGLPGIYTRVSKYVSWMQKV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/278 (26%)
Tryp_SPc 45..278 CDD:238113 73/277 (26%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 73/277 (26%)
Tryp_SPc 35..280 CDD:238113 73/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.