DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG7542

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:252 Identity:70/252 - (27%)
Similarity:110/252 - (43%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLH------STTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYE- 102
            |.||..|:....|:...|:      ||.    |||:||:...::|||||....:.:...||... 
  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTW----CGGTLISHYWIITAAHCMDGAESVTVYLGAINI 87

  Fly   103 RTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHR 165
            ...|||       .:|..||:..  ..|..|..:|..|||:::||...|.:.|.||...:  ..|
  Fly    88 GDESEE-------GQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASL--PRR 143

  Fly   166 WRHYLDKIDLLT--ATGWGKTQMESD--SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD- 225
            ........:.:.  |:|||:....||  |..|:.:::...|..:|..:....::....|..... 
  Fly   144 LNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSG 208

  Fly   226 SNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQKA--SVFTDVLSHAEFIL 279
            .:.|:|||||||    .:|.......:|..|: |:..||..  :|||.:.|:.::||
  Fly   209 KSTCHGDSGGPL----VYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWIL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/249 (27%)
Tryp_SPc 45..278 CDD:238113 68/249 (27%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 70/252 (28%)
Tryp_SPc 27..260 CDD:214473 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.