DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon74E

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:297 Identity:85/297 - (28%)
Similarity:131/297 - (44%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQL-LHSGCS-QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL--HSTTDMFV-C 71
            :..||:|.| |..|.| ..||...||      ..||..|..|:.|..|:.|.|  ....||:. |
  Fly     3 ISTILVFLLILVQGRSISCLDMGHGI------GGRIAGGELARANQFPYQVGLSIEEPNDMYCWC 61

  Fly    72 GGSLITDKLVLTAAHCF---IANQHL---VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            |.|||:|:.:||||||.   :|..:.   |.||...:..||..        .|.|:      |..
  Fly    62 GASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTN--------PEVHL------HPD 112

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD--SDAL 193
            ::..:..||||::||.:..:..|:||||.:......|:..|.:..: |:|||:...||.  ||.|
  Fly   113 WNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI-ASGWGRMNDESTAISDNL 176

  Fly   194 QTLDIRRQPPDVCAKFIGQTIAGNQFCAGNW--------------DSNLCNGDSGGPLGAVITHK 244
                          :::.:.:..|:.|..::              ..:.|.|||||||  |.:..
  Fly   177 --------------RYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPL--VYSDP 225

  Fly   245 NTQRFVQVGIASYTNRN-CQKA--SVFTDVLSHAEFI 278
            .....:.:|:.||..:: |.|.  ||||.:.::.::|
  Fly   226 VQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/261 (28%)
Tryp_SPc 45..278 CDD:238113 72/260 (28%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.