DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG18179

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:106/245 - (43%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTD----MFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERT 104
            ||:||:.|....:|::|.|...||    ..|..|::|....:||||||...         :|...
  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTT---------DYVEI 94

  Fly   105 RSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA---NDIAILRLSKSVVYRDNIRPICV-VWDHR 165
            ......|:...||:....|....|    ||..|   .||.::| :.||.:.|.|..:.: .:...
  Fly    95 HYGSNWGWNGAFRQSVRRDNFISH----PNWPAEGGRDIGLIR-TPSVGFTDLINKVALPSFSEE 154

  Fly   166 WRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD-SNLC 229
            ...::|  ....|.|||.....:.:|.||.:|::......|.:..| |:|....|....| .:.|
  Fly   155 SDRFVD--TWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYG-TVASTDMCTRRTDGKSSC 216

  Fly   230 NGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA-SVFTDVLSHAEFI 278
            .|||||||   :||.|.:   .||:.::.:.:|... |.:|.|..:..:|
  Fly   217 GGDSGGPL---VTHDNAR---LVGVITFGSVDCHSGPSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/243 (28%)
Tryp_SPc 45..278 CDD:238113 66/242 (27%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/243 (28%)
Tryp_SPc 40..263 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.