DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG3088

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:282 Identity:65/282 - (23%)
Similarity:104/282 - (36%) Gaps:83/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHL-----VARLGEYERT 104
            |.||..|....:|::|.:........|.|::|.|..:||:|.|...:..:     ..||.:.:.|
  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFT 93

  Fly   105 ----RSEECTGYYCNFREEHMV-----DAGFKHKLYDPNTHANDIAILRL-SKSVVYRDNIRPIC 159
                .||..||      .:|:.     ..||.:::       |.:|:..| ::|..|.:      
  Fly    94 VTVGTSEYVTG------NQHLALVRVPRVGFSNRV-------NRVALPSLRNRSQRYEN------ 139

  Fly   160 VVWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGN 223
              |   |.:         ..|||.|...:. :||||.:|::....:.|..|.|.|...:|.....
  Fly   140 --W---WAN---------VCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTR 190

  Fly   224 WDS--NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILRVWRMYG 286
            ..|  :.|.||:|.||   ||.:::   ..|||:::...|                         
  Fly   191 TPSGRSTCFGDAGSPL---ITKQDS---TVVGISAFVASN------------------------- 224

  Fly   287 KGQTLPIPKKPPTTTRPPTWWH 308
             |.||.:|......|....|.|
  Fly   225 -GCTLGLPAGFARITSALDWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 58/250 (23%)
Tryp_SPc 45..278 CDD:238113 58/250 (23%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 65/282 (23%)
Tryp_SPc 29..244 CDD:214473 63/279 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.