DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG33460

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:290 Identity:82/290 - (28%)
Similarity:137/290 - (47%) Gaps:46/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLL---HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSS--PWMVFLHSTTDMFVC 71
            :.::..:.|:   .|..:.:|...||:..:             ::::|  ||...||:...:| |
  Fly     7 ISLLASYMLVIYSDSVSANYLYEQCGLMRE-------------EFSTSLGPWTALLHTDGSIF-C 57

  Fly    72 GGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTH 136
            .|:||||..:||||.|...|. :..||||:.|..:|        ..|:|:|.....::|::..:.
  Fly    58 AGTLITDVFILTAASCIRPNA-VKVRLGEFGRYPNE--------LPEDHLVHYFLMYRLFNNESL 113

  Fly   137 ANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIR-- 199
            ||:|.:|:|:|.|...|.|.|:|:|.:.:      ...|.|....|...|| ||:...|.::|  
  Fly   114 ANNIGLLKLTKRVQITDYIMPVCIVLNPQ------NQQLSTMRFIGNAWME-DSNVSLTKELRPI 171

  Fly   200 --RQPPDVCAKFIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNR 260
              :..|.:|......|    |||||: ..||  |:|.:|..|.....:.|..|.:|.|||:..:.
  Fly   172 VIQSKPKMCTNLDLYT----QFCAGH-QGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDM 231

  Fly   261 NCQKASVFTDVLSHAEFILRVWRMYGKGQT 290
            :|:::..:||||....:|..|..::....|
  Fly   232 DCEESQGYTDVLKFYWWIQDVVSLFNHYST 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/241 (31%)
Tryp_SPc 45..278 CDD:238113 74/240 (31%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 74/229 (32%)
Tryp_SPc 44..249 CDD:214473 73/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.