DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG33465

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:292 Identity:91/292 - (31%)
Similarity:140/292 - (47%) Gaps:41/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM 68
            ||||:           :|..|.:|.||..|   ...:|:..|...|.|. .::|||..::. .:.
  Fly     8 ALIGL-----------VLCQGLAQLLDKKC---HDPKTSENINFNHGAT-ETAPWMASIYK-NNQ 56

  Fly    69 FVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP 133
            |:|.|:|:....|||||.|...:..|....|.|.:.|  :.:.::.|  |::.|....:|..:.|
  Fly    57 FICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYR--DASQFFNN--EQYGVAVALQHSNFRP 117

  Fly   134 NTHANDIAILRLSKSVVYRDNIRPICVVWDH--------RWRHYLDKIDLLTATGWGKTQMESDS 190
            |...|||.:|||...|.:..:|||||::.||        |:..:          ||.:...|:.|
  Fly   118 NNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGF----------GWQQQGTEASS 172

  Fly   191 DALQTLDIRRQPPDVCAKFIGQTIAGN--QFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVG 253
            ...||:.:.::.|..|.: .||.:..|  ||||||.|.:.|..:||.||.|..|:......||||
  Fly   173 QVRQTVYLSQKKPFECHR-NGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVG 236

  Fly   254 IASYTNRNCQKASVFTDVLSHAEFILRVWRMY 285
            :.||.:..|...||:|||::..::|....|.:
  Fly   237 LVSYGSELCSPTSVYTDVVAFKDWIYNTVRNF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/243 (32%)
Tryp_SPc 45..278 CDD:238113 78/242 (32%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 76/233 (33%)
Tryp_SPc 46..261 CDD:214473 75/230 (33%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463390
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.