DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG10469

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:308 Identity:72/308 - (23%)
Similarity:124/308 - (40%) Gaps:82/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMV-----FLHSTTDMFVCGG 73
            :|:.|.|:..              |...:.||:||..||....|:.|     |..|..:..:|||
  Fly     7 LIVQFSLVFG--------------QETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGG 57

  Fly    74 SLITDKLVLTAAHCF-IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFK--HKLYDPNT 135
            ::::::.::|||||. ....:|...|....:.:|.:        .:|.:|:..:.  ||.:|..|
  Fly    58 TILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFD--------DKEIVVNRSYTIVHKKFDRKT 114

  Fly   136 HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRR 200
            ..||||:::|.|.:.:...|:|..:  ....:.|..:..::  :|||.|..:..|..||      
  Fly   115 VTNDIALIKLPKKLTFNKYIQPAKL--PSAKKTYTGRKAII--SGWGLTTKQLPSQVLQ------ 169

  Fly   201 QPPDVCAKFIGQTIAGNQFCAGNWDSNL----------------------CNGDSGGPLGAVITH 243
                    :|...|..|:.|...|:..|                      |.||||||:   :..
  Fly   170 --------YIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPM---VLD 223

  Fly   244 KNTQRFVQVGIASY-TNRNC--QKASVFTDVLSHAEFILRVWRMYGKG 288
            ..::..  |||.|: .:..|  :...|.|.|.|:.::|    :.|..|
  Fly   224 DGSRTL--VGIVSHGFDGECKLKLPDVSTRVSSYLKWI----KYYSGG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/266 (24%)
Tryp_SPc 45..278 CDD:238113 64/265 (24%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 65/266 (24%)
Tryp_SPc 24..260 CDD:238113 65/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.