DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG6592

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:250 Identity:74/250 - (29%)
Similarity:122/250 - (48%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMV--FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            ||..|.....:..|:.|  .|.....::.||||||:||.|:|||||....:..:..||..|    
  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANE---- 182

  Fly   107 EECTGYYCNFREEHMV-----DAGFK-HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDH- 164
                  ..|.:|:..|     ...|: :..::|....:||||:||..:|.:.:.|.||.:...| 
  Fly   183 ------IKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHY 241

  Fly   165 RWRHYLDKIDLLTATGWGK--TQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFC-AGNWDS 226
            .:|.:.:|  |..|:|||:  |.:.:.|:.|:.:.::......|......:..|...| :|....
  Fly   242 EYRSFKNK--LAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNAR 304

  Fly   227 NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN-RNCQKA--SVFTDVLSHAEFI 278
            :.|||||||||  |:..:::::.|.|||.|:.: ..|.:.  :.||.|.|:.::|
  Fly   305 STCNGDSGGPL--VLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/248 (29%)
Tryp_SPc 45..278 CDD:238113 72/247 (29%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/248 (29%)
Tryp_SPc 123..359 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.