DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:233 Identity:62/233 - (26%)
Similarity:97/233 - (41%) Gaps:58/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTD--MFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            ||..|:.|.....|::|.|..:.:  ...||||:|.:..|:||.||               ....
  Fly    37 RITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHC---------------TDGM 86

  Fly   107 EECTGYYCNFREEHMVDAGFKHKLYDPNTH-----------ANDIAILRLSK----SVVYRDNIR 156
            |..|.||           |...:|....||           :.||:::|...    |:|.:..:.
  Fly    87 ESVTIYY-----------GALWRLQAQYTHWVGRSDFIEHGSGDISLIRTPHVDFWSLVNKVELP 140

  Fly   157 PICVVWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFC 220
            .    :|.|:.:|.....|:  :|||||..|.. |:.|..:|::.....||..:.| :.:|:..|
  Fly   141 R----YDDRYNNYQGWWALV--SGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYG-SFSGDLIC 198

  Fly   221 AGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            ....:: ..|:|||||||   :.|...:   ||||.|:
  Fly   199 IPTPENKGTCSGDSGGPL---VIHDGNR---QVGIVSF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/233 (27%)
Tryp_SPc 45..278 CDD:238113 61/232 (26%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 62/233 (27%)
Tryp_SPc 41..257 CDD:238113 60/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.