DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:227 Identity:68/227 - (29%)
Similarity:98/227 - (43%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMV---FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTR 105
            ||.||:.|.....|::|   |.:.....:.||||:|..:.|||||||.....::....|...|.:
  Fly    36 RITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQ 100

  Fly   106 SEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSK----SVVYRDNIRPICVVWDHRW 166
            .:                  |.|  ||.....||||::|...    |:|.:..:..    :|.|:
  Fly   101 PQ------------------FTH--YDTGNLHNDIALIRTPHVDFWSLVNKVELPR----YDDRY 141

  Fly   167 RHYLDKIDLLTATGWGKTQMESDS----DALQTLDIRRQPPDVCAKFIG-QTIAGNQFC-AGNWD 225
            .::.....||  :|||.:   |||    |.|..:||:.....||..:.| ..|..|..| |...:
  Fly   142 NNFYGWWALL--SGWGSS---SDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPEN 201

  Fly   226 SNLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            ...|:|||||||   :.|...:   ||||.|:
  Fly   202 KGSCSGDSGGPL---VLHDGNR---QVGIVSF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/227 (30%)
Tryp_SPc 45..278 CDD:238113 67/226 (30%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 68/227 (30%)
Tryp_SPc 37..254 CDD:238113 67/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.