DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:266 Identity:68/266 - (25%)
Similarity:109/266 - (40%) Gaps:69/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLH--STTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            ||.||.||.....|:.|.|.  ||:..:.||||:|.:..|||||||......:....|...||.:
  Fly    39 RITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSA 103

  Fly   107 EECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLD 171
            :        ..:....|...:|..|:.....|||:::: :.:|.:               ...::
  Fly   104 Q--------LVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAF---------------TALIN 144

  Fly   172 KIDL--------------LTATGWGKTQMESDS----------DALQTLDIRRQPPDVCAKFIGQ 212
            |::|              ..|:|||||   |||          :..:.:.:.:     |....|.
  Fly   145 KVELPAIAGTYSTYTGQQAIASGWGKT---SDSATSVANTLQYEVFEVVSVSQ-----CQNTYGS 201

  Fly   213 TIA-GNQFCAGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQKASV--FTDVL 272
            .:| .|..|....:. :.|||||||||..|...|      .:|:.|: ::..|:..:.  ||.|.
  Fly   202 LVATNNVICVATPNKVSTCNGDSGGPLVLVSDSK------LIGVTSFVSSAGCESGAPAGFTRVT 260

  Fly   273 SHAEFI 278
            |:.::|
  Fly   261 SYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/264 (25%)
Tryp_SPc 45..278 CDD:238113 66/263 (25%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 67/264 (25%)
Tryp_SPc 40..269 CDD:238113 67/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.