DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:286 Identity:81/286 - (28%)
Similarity:124/286 - (43%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LMFQLLHSGCSQFLDPACGIRTQSR-------TAYRIINGHTAKYNSSPWMVFLH---STTDMFV 70
            |:...|....|.|.:|.  :|.:||       ...||..|..|.....|:.|.|.   |......
  Fly     4 LIILALAVAASAFPEPE--LRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAW 66

  Fly    71 CGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDP 133
            ||||||....|||||||....|.:...||...|| |.|.|         |.|.:.  ..|..::.
  Fly    67 CGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRT-SAEIT---------HTVSSSDIIIHSGWNS 121

  Fly   134 NTHANDIAILRL----SKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDA-- 192
            ....|||:::::    |.|.:....:..|    .:.:..::.  |:..|:|||:|...|...|  
  Fly   122 ANLRNDISLIKIPATSSSSRISAVKLPSI----SNSYSTFVG--DVAVASGWGRTSDTSSGVATN 180

  Fly   193 LQTLDIRRQPPDVCAKFIG-QTIAGNQFCAGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQVGIA 255
            ||.:|:.......||:..| ..:..:..|....|: :.|||||||||   :...:::   |:|:.
  Fly   181 LQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPL---VLKSSSE---QIGLT 239

  Fly   256 SY-TNRNCQKA--SVFTDVLSHAEFI 278
            |: .:..|:|.  :.||.|.|:.::|
  Fly   240 SFGASAGCEKGYPAAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/249 (29%)
Tryp_SPc 45..278 CDD:238113 71/248 (29%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 72/249 (29%)
Tryp_SPc 38..268 CDD:238113 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.