DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and yip7

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:114/260 - (43%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMVFL--HSTTDMFVCGGSLITDKLVLTAAHCFIANQH 93
            |...:.|.|.|. ||.||..|.....|:.|.|  .|:...:.||||:|.::.|||||||......
  Fly    27 PRDRVSTPSITG-RITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAAS 90

  Fly    94 LVARLGEYERTRSEECTGYYCN--FREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
            :....|...|| |.|.|....:  ||:         |:.|...|..|||::::.| ||.:...:.
  Fly    91 VTIYYGATVRT-SPEFTQVVSSSKFRQ---------HESYLALTIRNDISLIQTS-SVSFSATVN 144

  Fly   157 PICV-VWDHRWRHYLDKIDLLTATGWGKT--QMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQ 218
            .|.: ...:.:..|..|  ...|:|||.|  |..:.|..||.:|:.......|.:..|..|..::
  Fly   145 KISLPAVSNSYSTYEGK--TAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSR 207

  Fly   219 -FCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN-CQKA--SVFTDVLSHAEFI 278
             .|....: ::.|.|||||||..        ..|.:|..|:.:.: |:..  :.||.:..:.::|
  Fly   208 VLCVDTTNKASTCQGDSGGPLAL--------DGVLIGATSFGSADGCESGAPAAFTRITYYRDWI 264

  Fly   279  278
              Fly   265  264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/245 (28%)
Tryp_SPc 45..278 CDD:238113 68/244 (28%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 69/245 (28%)
Tryp_SPc 40..267 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.